Anti COX11 pAb (ATL-HPA044020)

Atlas Antibodies

Catalog No.: ATL-HPA044020-25

Protein Description: cytochrome c oxidase assembly homolog 11 (yeast)
Gene Name: COX11
Alternative Gene Name: COX11P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020544: 96%, ENSRNOG00000052096: 95%
Entrez Gene ID: 1353
Uniprot ID: Q9Y6N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPG
• Gene Sequence: DKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPG
• Gene ID - Mouse: ENSMUSG00000020544
• Gene ID - Rat: ENSRNOG00000052096
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COX11 pAb (ATL-HPA044020) – 1 Found

Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494.