Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008918-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: COTL1
Alternative Gene Name: CLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031827: 95%, ENSRNOG00000016257: 96%
Entrez Gene ID: 23406
Uniprot ID: Q14019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL |
Gene Sequence | IWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL |
Gene ID - Mouse | ENSMUSG00000031827 |
Gene ID - Rat | ENSRNOG00000016257 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) | |
Datasheet | Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) | |
Datasheet | Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) |
Citations for Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) – 2 Found |
Rangaraju, Srikant; Dammer, Eric B; Raza, Syed Ali; Gao, Tianwen; Xiao, Hailian; Betarbet, Ranjita; Duong, Duc M; Webster, James A; Hales, Chadwick M; Lah, James J; Levey, Allan I; Seyfried, Nicholas T. Quantitative proteomics of acutely-isolated mouse microglia identifies novel immune Alzheimer's disease-related proteins. Molecular Neurodegeneration. 2018;13(1):34. PubMed |
Rayaprolu, Sruti; Gao, Tianwen; Xiao, Hailian; Ramesha, Supriya; Weinstock, Laura D; Shah, Jheel; Duong, Duc M; Dammer, Eric B; Webster, James A Jr; Lah, James J; Wood, Levi B; Betarbet, Ranjita; Levey, Allan I; Seyfried, Nicholas T; Rangaraju, Srikant. Flow-cytometric microglial sorting coupled with quantitative proteomics identifies moesin as a highly-abundant microglial protein with relevance to Alzheimer's disease. Molecular Neurodegeneration. 2020;15(1):28. PubMed |