Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA008918-100
  • Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA008918 antibody. Corresponding COTL1 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line CAPAN-2.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: coactosin-like F-actin binding protein 1
Gene Name: COTL1
Alternative Gene Name: CLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031827: 95%, ENSRNOG00000016257: 96%
Entrez Gene ID: 23406
Uniprot ID: Q14019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
Gene Sequence IWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
Gene ID - Mouse ENSMUSG00000031827
Gene ID - Rat ENSRNOG00000016257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation)
Datasheet Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation)
Datasheet Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation)



Citations for Anti COTL1 pAb (ATL-HPA008918 w/enhanced validation) – 2 Found
Rangaraju, Srikant; Dammer, Eric B; Raza, Syed Ali; Gao, Tianwen; Xiao, Hailian; Betarbet, Ranjita; Duong, Duc M; Webster, James A; Hales, Chadwick M; Lah, James J; Levey, Allan I; Seyfried, Nicholas T. Quantitative proteomics of acutely-isolated mouse microglia identifies novel immune Alzheimer's disease-related proteins. Molecular Neurodegeneration. 2018;13(1):34.  PubMed
Rayaprolu, Sruti; Gao, Tianwen; Xiao, Hailian; Ramesha, Supriya; Weinstock, Laura D; Shah, Jheel; Duong, Duc M; Dammer, Eric B; Webster, James A Jr; Lah, James J; Wood, Levi B; Betarbet, Ranjita; Levey, Allan I; Seyfried, Nicholas T; Rangaraju, Srikant. Flow-cytometric microglial sorting coupled with quantitative proteomics identifies moesin as a highly-abundant microglial protein with relevance to Alzheimer's disease. Molecular Neurodegeneration. 2020;15(1):28.  PubMed