Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041302-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CORO2A
Alternative Gene Name: IR10, WDR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028337: 78%, ENSRNOG00000008901: 79%
Entrez Gene ID: 7464
Uniprot ID: Q92828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQ |
| Gene Sequence | WRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQ |
| Gene ID - Mouse | ENSMUSG00000028337 |
| Gene ID - Rat | ENSRNOG00000008901 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) | |
| Datasheet | Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) | |
| Datasheet | Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) |
| Citations for Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) – 1 Found |
| Deng, Jun-Li; Zhang, Hai-Bo; Zeng, Ying; Xu, Yun-Hua; Huang, Ying; Wang, Guo. Effects of CORO2A on Cell Migration and Proliferation and Its Potential Regulatory Network in Breast Cancer. Frontiers In Oncology. 10( 32695665):916. PubMed |