Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041302-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coronin, actin binding protein, 2A
Gene Name: CORO2A
Alternative Gene Name: IR10, WDR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028337: 78%, ENSRNOG00000008901: 79%
Entrez Gene ID: 7464
Uniprot ID: Q92828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQ
Gene Sequence WRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQ
Gene ID - Mouse ENSMUSG00000028337
Gene ID - Rat ENSRNOG00000008901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation)
Datasheet Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation)
Datasheet Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation)
Citations for Anti CORO2A pAb (ATL-HPA041302 w/enhanced validation) – 1 Found
Deng, Jun-Li; Zhang, Hai-Bo; Zeng, Ying; Xu, Yun-Hua; Huang, Ying; Wang, Guo. Effects of CORO2A on Cell Migration and Proliferation and Its Potential Regulatory Network in Breast Cancer. Frontiers In Oncology. 10( 32695665):916.  PubMed