Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041161-100
Immunohistochemistry analysis in human small intestine and pancreas tissues using HPA041161 antibody. Corresponding CORO2A RNA-seq data are presented for the same tissues.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: coronin, actin binding protein, 2A
Gene Name: CORO2A
Alternative Gene Name: IR10, WDR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028337: 67%, ENSRNOG00000008901: 66%
Entrez Gene ID: 7464
Uniprot ID: Q92828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
Gene Sequence DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
Gene ID - Mouse ENSMUSG00000028337
Gene ID - Rat ENSRNOG00000008901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation)
Datasheet Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation)
Datasheet Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation)
!