Anti CORO2A pAb (ATL-HPA041161 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041161-100

• 
• 

Protein Description: coronin, actin binding protein, 2A
Gene Name: CORO2A
Alternative Gene Name: IR10, WDR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028337: 67%, ENSRNOG00000008901: 66%
Entrez Gene ID: 7464
Uniprot ID: Q92828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
• Gene Sequence: DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
• Gene ID - Mouse: ENSMUSG00000028337
• Gene ID - Rat: ENSRNOG00000008901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.