Anti CORO1C pAb (ATL-HPA041737)

Atlas Antibodies

Catalog No.:
ATL-HPA041737-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: coronin, actin binding protein, 1C
Gene Name: CORO1C
Alternative Gene Name: coronin-3, HCRNN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004530: 87%, ENSRNOG00000000697: 93%
Entrez Gene ID: 23603
Uniprot ID: Q9ULV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
Gene Sequence ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
Gene ID - Mouse ENSMUSG00000004530
Gene ID - Rat ENSRNOG00000000697
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CORO1C pAb (ATL-HPA041737)
Datasheet Anti CORO1C pAb (ATL-HPA041737) Datasheet (External Link)
Vendor Page Anti CORO1C pAb (ATL-HPA041737) at Atlas Antibodies

Documents & Links for Anti CORO1C pAb (ATL-HPA041737)
Datasheet Anti CORO1C pAb (ATL-HPA041737) Datasheet (External Link)
Vendor Page Anti CORO1C pAb (ATL-HPA041737)