Anti CORO1C pAb (ATL-HPA041737)

Atlas Antibodies

SKU: ATL-HPA041737-25

• 

Protein Description: coronin, actin binding protein, 1C
Gene Name: CORO1C
Alternative Gene Name: coronin-3, HCRNN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004530: 87%, ENSRNOG00000000697: 93%
Entrez Gene ID: 23603
Uniprot ID: Q9ULV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
• Gene Sequence: ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
• Gene ID - Mouse: ENSMUSG00000004530
• Gene ID - Rat: ENSRNOG00000000697
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.