Anti CORO1C pAb (ATL-HPA041737)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041737-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CORO1C
Alternative Gene Name: coronin-3, HCRNN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004530: 87%, ENSRNOG00000000697: 93%
Entrez Gene ID: 23603
Uniprot ID: Q9ULV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI |
Gene Sequence | ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI |
Gene ID - Mouse | ENSMUSG00000004530 |
Gene ID - Rat | ENSRNOG00000000697 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CORO1C pAb (ATL-HPA041737) | |
Datasheet | Anti CORO1C pAb (ATL-HPA041737) Datasheet (External Link) |
Vendor Page | Anti CORO1C pAb (ATL-HPA041737) at Atlas Antibodies |
Documents & Links for Anti CORO1C pAb (ATL-HPA041737) | |
Datasheet | Anti CORO1C pAb (ATL-HPA041737) Datasheet (External Link) |
Vendor Page | Anti CORO1C pAb (ATL-HPA041737) |