Anti CORO1B pAb (ATL-HPA040113)

Atlas Antibodies

SKU:
ATL-HPA040113-25
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coronin, actin binding protein, 1B
Gene Name: CORO1B
Alternative Gene Name: coronin-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097771: 78%, ENSRNOG00000021828: 76%
Entrez Gene ID: 57175
Uniprot ID: Q9BR76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
Gene Sequence AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
Gene ID - Mouse ENSMUSG00000097771
Gene ID - Rat ENSRNOG00000021828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CORO1B pAb (ATL-HPA040113)
Datasheet Anti CORO1B pAb (ATL-HPA040113) Datasheet (External Link)
Vendor Page Anti CORO1B pAb (ATL-HPA040113) at Atlas Antibodies

Documents & Links for Anti CORO1B pAb (ATL-HPA040113)
Datasheet Anti CORO1B pAb (ATL-HPA040113) Datasheet (External Link)
Vendor Page Anti CORO1B pAb (ATL-HPA040113)