Anti CORO1B pAb (ATL-HPA040113)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040113-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CORO1B
Alternative Gene Name: coronin-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097771: 78%, ENSRNOG00000021828: 76%
Entrez Gene ID: 57175
Uniprot ID: Q9BR76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD |
| Gene Sequence | AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD |
| Gene ID - Mouse | ENSMUSG00000097771 |
| Gene ID - Rat | ENSRNOG00000021828 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CORO1B pAb (ATL-HPA040113) | |
| Datasheet | Anti CORO1B pAb (ATL-HPA040113) Datasheet (External Link) |
| Vendor Page | Anti CORO1B pAb (ATL-HPA040113) at Atlas Antibodies |
| Documents & Links for Anti CORO1B pAb (ATL-HPA040113) | |
| Datasheet | Anti CORO1B pAb (ATL-HPA040113) Datasheet (External Link) |
| Vendor Page | Anti CORO1B pAb (ATL-HPA040113) |