Anti COQ9 pAb (ATL-HPA040918)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040918-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: COQ9
Alternative Gene Name: C16orf49, DKFZP434K046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031782: 96%, ENSRNOG00000016190: 95%
Entrez Gene ID: 57017
Uniprot ID: O75208
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL |
| Gene Sequence | DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL |
| Gene ID - Mouse | ENSMUSG00000031782 |
| Gene ID - Rat | ENSRNOG00000016190 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COQ9 pAb (ATL-HPA040918) | |
| Datasheet | Anti COQ9 pAb (ATL-HPA040918) Datasheet (External Link) |
| Vendor Page | Anti COQ9 pAb (ATL-HPA040918) at Atlas Antibodies |
| Documents & Links for Anti COQ9 pAb (ATL-HPA040918) | |
| Datasheet | Anti COQ9 pAb (ATL-HPA040918) Datasheet (External Link) |
| Vendor Page | Anti COQ9 pAb (ATL-HPA040918) |