Anti COQ9 pAb (ATL-HPA040918)

Atlas Antibodies

Catalog No.:
ATL-HPA040918-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coenzyme Q9
Gene Name: COQ9
Alternative Gene Name: C16orf49, DKFZP434K046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031782: 96%, ENSRNOG00000016190: 95%
Entrez Gene ID: 57017
Uniprot ID: O75208
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL
Gene Sequence DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL
Gene ID - Mouse ENSMUSG00000031782
Gene ID - Rat ENSRNOG00000016190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COQ9 pAb (ATL-HPA040918)
Datasheet Anti COQ9 pAb (ATL-HPA040918) Datasheet (External Link)
Vendor Page Anti COQ9 pAb (ATL-HPA040918) at Atlas Antibodies

Documents & Links for Anti COQ9 pAb (ATL-HPA040918)
Datasheet Anti COQ9 pAb (ATL-HPA040918) Datasheet (External Link)
Vendor Page Anti COQ9 pAb (ATL-HPA040918)