Anti COQ8B pAb (ATL-HPA027229)

Atlas Antibodies

SKU:
ATL-HPA027229-25
  • Immunohistochemical staining of human fallopian tube shows moderate  membranous and cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis in human cell line A-549.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coenzyme Q8B
Gene Name: COQ8B
Alternative Gene Name: ADCK4, COQ8, FLJ12229
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003762: 89%, ENSRNOG00000020848: 88%
Entrez Gene ID: 79934
Uniprot ID: Q96D53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLR
Gene Sequence ACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLR
Gene ID - Mouse ENSMUSG00000003762
Gene ID - Rat ENSRNOG00000020848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COQ8B pAb (ATL-HPA027229)
Datasheet Anti COQ8B pAb (ATL-HPA027229) Datasheet (External Link)
Vendor Page Anti COQ8B pAb (ATL-HPA027229) at Atlas Antibodies

Documents & Links for Anti COQ8B pAb (ATL-HPA027229)
Datasheet Anti COQ8B pAb (ATL-HPA027229) Datasheet (External Link)
Vendor Page Anti COQ8B pAb (ATL-HPA027229)