Anti COQ7 pAb (ATL-HPA071922)

Atlas Antibodies

Catalog No.: ATL-HPA071922-25

Protein Description: coenzyme Q7 homolog, ubiquinone (yeast)
Gene Name: COQ7
Alternative Gene Name: CAT5, CLK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030652: 92%, ENSRNOG00000017012: 92%
Entrez Gene ID: 10229
Uniprot ID: Q99807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR
• Gene Sequence: TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR
• Gene ID - Mouse: ENSMUSG00000030652
• Gene ID - Rat: ENSRNOG00000017012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.