Anti COQ7 pAb (ATL-HPA071922)

Atlas Antibodies

Catalog No.:
ATL-HPA071922-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coenzyme Q7 homolog, ubiquinone (yeast)
Gene Name: COQ7
Alternative Gene Name: CAT5, CLK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030652: 92%, ENSRNOG00000017012: 92%
Entrez Gene ID: 10229
Uniprot ID: Q99807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR
Gene Sequence TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR
Gene ID - Mouse ENSMUSG00000030652
Gene ID - Rat ENSRNOG00000017012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COQ7 pAb (ATL-HPA071922)
Datasheet Anti COQ7 pAb (ATL-HPA071922) Datasheet (External Link)
Vendor Page Anti COQ7 pAb (ATL-HPA071922) at Atlas Antibodies

Documents & Links for Anti COQ7 pAb (ATL-HPA071922)
Datasheet Anti COQ7 pAb (ATL-HPA071922) Datasheet (External Link)
Vendor Page Anti COQ7 pAb (ATL-HPA071922)