Anti COQ6 pAb (ATL-HPA051371)

Atlas Antibodies

Catalog No.:
ATL-HPA051371-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coenzyme Q6 monooxygenase
Gene Name: COQ6
Alternative Gene Name: CGI-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021235: 92%, ENSRNOG00000011164: 92%
Entrez Gene ID: 51004
Uniprot ID: Q9Y2Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLE
Gene Sequence NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLE
Gene ID - Mouse ENSMUSG00000021235
Gene ID - Rat ENSRNOG00000011164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COQ6 pAb (ATL-HPA051371)
Datasheet Anti COQ6 pAb (ATL-HPA051371) Datasheet (External Link)
Vendor Page Anti COQ6 pAb (ATL-HPA051371) at Atlas Antibodies

Documents & Links for Anti COQ6 pAb (ATL-HPA051371)
Datasheet Anti COQ6 pAb (ATL-HPA051371) Datasheet (External Link)
Vendor Page Anti COQ6 pAb (ATL-HPA051371)