Anti COQ6 pAb (ATL-HPA051371)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051371-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: COQ6
Alternative Gene Name: CGI-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021235: 92%, ENSRNOG00000011164: 92%
Entrez Gene ID: 51004
Uniprot ID: Q9Y2Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLE |
Gene Sequence | NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLE |
Gene ID - Mouse | ENSMUSG00000021235 |
Gene ID - Rat | ENSRNOG00000011164 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COQ6 pAb (ATL-HPA051371) | |
Datasheet | Anti COQ6 pAb (ATL-HPA051371) Datasheet (External Link) |
Vendor Page | Anti COQ6 pAb (ATL-HPA051371) at Atlas Antibodies |
Documents & Links for Anti COQ6 pAb (ATL-HPA051371) | |
Datasheet | Anti COQ6 pAb (ATL-HPA051371) Datasheet (External Link) |
Vendor Page | Anti COQ6 pAb (ATL-HPA051371) |