Anti COQ5 pAb (ATL-HPA049487)

Atlas Antibodies

Catalog No.:
ATL-HPA049487-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coenzyme Q5 homolog, methyltransferase (S. cerevisiae)
Gene Name: COQ5
Alternative Gene Name: MGC4767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041733: 89%, ENSRNOG00000001171: 94%
Entrez Gene ID: 84274
Uniprot ID: Q5HYK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL
Gene Sequence PGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL
Gene ID - Mouse ENSMUSG00000041733
Gene ID - Rat ENSRNOG00000001171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COQ5 pAb (ATL-HPA049487)
Datasheet Anti COQ5 pAb (ATL-HPA049487) Datasheet (External Link)
Vendor Page Anti COQ5 pAb (ATL-HPA049487) at Atlas Antibodies

Documents & Links for Anti COQ5 pAb (ATL-HPA049487)
Datasheet Anti COQ5 pAb (ATL-HPA049487) Datasheet (External Link)
Vendor Page Anti COQ5 pAb (ATL-HPA049487)