Anti COQ5 pAb (ATL-HPA049487)

Atlas Antibodies

Catalog No.: ATL-HPA049487-25

Protein Description: coenzyme Q5 homolog, methyltransferase (S. cerevisiae)
Gene Name: COQ5
Alternative Gene Name: MGC4767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041733: 89%, ENSRNOG00000001171: 94%
Entrez Gene ID: 84274
Uniprot ID: Q5HYK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL
• Gene Sequence: PGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL
• Gene ID - Mouse: ENSMUSG00000041733
• Gene ID - Rat: ENSRNOG00000001171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.