Anti COQ10B pAb (ATL-HPA046057)

Atlas Antibodies

Catalog No.: ATL-HPA046057-25

Protein Description: coenzyme Q10 homolog B (S. cerevisiae)
Gene Name: COQ10B
Alternative Gene Name: FLJ13448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025981: 61%, ENSRNOG00000014456: 64%
Entrez Gene ID: 80219
Uniprot ID: Q9H8M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
• Gene Sequence: ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
• Gene ID - Mouse: ENSMUSG00000025981
• Gene ID - Rat: ENSRNOG00000014456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.