Anti COQ10B pAb (ATL-HPA046057)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046057-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: COQ10B
Alternative Gene Name: FLJ13448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025981: 61%, ENSRNOG00000014456: 64%
Entrez Gene ID: 80219
Uniprot ID: Q9H8M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK |
Gene Sequence | ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK |
Gene ID - Mouse | ENSMUSG00000025981 |
Gene ID - Rat | ENSRNOG00000014456 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COQ10B pAb (ATL-HPA046057) | |
Datasheet | Anti COQ10B pAb (ATL-HPA046057) Datasheet (External Link) |
Vendor Page | Anti COQ10B pAb (ATL-HPA046057) at Atlas Antibodies |
Documents & Links for Anti COQ10B pAb (ATL-HPA046057) | |
Datasheet | Anti COQ10B pAb (ATL-HPA046057) Datasheet (External Link) |
Vendor Page | Anti COQ10B pAb (ATL-HPA046057) |