Anti COQ10A pAb (ATL-HPA068931)

Atlas Antibodies

Catalog No.:
ATL-HPA068931-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: coenzyme Q10A
Gene Name: COQ10A
Alternative Gene Name: FLJ32452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039914: 97%, ENSRNOG00000029571: 97%
Entrez Gene ID: 93058
Uniprot ID: Q96MF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEV
Gene Sequence YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEV
Gene ID - Mouse ENSMUSG00000039914
Gene ID - Rat ENSRNOG00000029571
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COQ10A pAb (ATL-HPA068931)
Datasheet Anti COQ10A pAb (ATL-HPA068931) Datasheet (External Link)
Vendor Page Anti COQ10A pAb (ATL-HPA068931) at Atlas Antibodies

Documents & Links for Anti COQ10A pAb (ATL-HPA068931)
Datasheet Anti COQ10A pAb (ATL-HPA068931) Datasheet (External Link)
Vendor Page Anti COQ10A pAb (ATL-HPA068931)