Anti COPS9 pAb (ATL-HPA044845)

Atlas Antibodies

SKU: ATL-HPA044845-25

• 
• 

Protein Description: COP9 signalosome subunit 9
Gene Name: COPS9
Alternative Gene Name: CSNAP, MYEOV2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073001: 26%, ENSRNOG00000004050: 27%
Entrez Gene ID: 150678
Uniprot ID: Q8WXC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC
• Gene Sequence: ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC
• Gene ID - Mouse: ENSMUSG00000073001
• Gene ID - Rat: ENSRNOG00000004050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.