Anti COPS9 pAb (ATL-HPA044845)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044845-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: COPS9
Alternative Gene Name: CSNAP, MYEOV2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073001: 26%, ENSRNOG00000004050: 27%
Entrez Gene ID: 150678
Uniprot ID: Q8WXC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC |
| Gene Sequence | ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC |
| Gene ID - Mouse | ENSMUSG00000073001 |
| Gene ID - Rat | ENSRNOG00000004050 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPS9 pAb (ATL-HPA044845) | |
| Datasheet | Anti COPS9 pAb (ATL-HPA044845) Datasheet (External Link) |
| Vendor Page | Anti COPS9 pAb (ATL-HPA044845) at Atlas Antibodies |
| Documents & Links for Anti COPS9 pAb (ATL-HPA044845) | |
| Datasheet | Anti COPS9 pAb (ATL-HPA044845) Datasheet (External Link) |
| Vendor Page | Anti COPS9 pAb (ATL-HPA044845) |