Anti COPS9 pAb (ATL-HPA044845)

Atlas Antibodies

Catalog No.:
ATL-HPA044845-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: COP9 signalosome subunit 9
Gene Name: COPS9
Alternative Gene Name: CSNAP, MYEOV2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073001: 26%, ENSRNOG00000004050: 27%
Entrez Gene ID: 150678
Uniprot ID: Q8WXC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC
Gene Sequence ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC
Gene ID - Mouse ENSMUSG00000073001
Gene ID - Rat ENSRNOG00000004050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPS9 pAb (ATL-HPA044845)
Datasheet Anti COPS9 pAb (ATL-HPA044845) Datasheet (External Link)
Vendor Page Anti COPS9 pAb (ATL-HPA044845) at Atlas Antibodies

Documents & Links for Anti COPS9 pAb (ATL-HPA044845)
Datasheet Anti COPS9 pAb (ATL-HPA044845) Datasheet (External Link)
Vendor Page Anti COPS9 pAb (ATL-HPA044845)