Anti COPS8 pAb (ATL-HPA036485)

Atlas Antibodies

SKU: ATL-HPA036485-25

• 
• 

Protein Description: COP9 signalosome subunit 8
Gene Name: COPS8
Alternative Gene Name: COP9, CSN8, MGC1297, SGN8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034432: 88%, ENSRNOG00000019635: 90%
Entrez Gene ID: 10920
Uniprot ID: Q99627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP
• Gene Sequence: VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP
• Gene ID - Mouse: ENSMUSG00000034432
• Gene ID - Rat: ENSRNOG00000019635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.