Anti COPS8 pAb (ATL-HPA036485)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036485-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: COPS8
Alternative Gene Name: COP9, CSN8, MGC1297, SGN8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034432: 88%, ENSRNOG00000019635: 90%
Entrez Gene ID: 10920
Uniprot ID: Q99627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP |
| Gene Sequence | VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP |
| Gene ID - Mouse | ENSMUSG00000034432 |
| Gene ID - Rat | ENSRNOG00000019635 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPS8 pAb (ATL-HPA036485) | |
| Datasheet | Anti COPS8 pAb (ATL-HPA036485) Datasheet (External Link) |
| Vendor Page | Anti COPS8 pAb (ATL-HPA036485) at Atlas Antibodies |
| Documents & Links for Anti COPS8 pAb (ATL-HPA036485) | |
| Datasheet | Anti COPS8 pAb (ATL-HPA036485) Datasheet (External Link) |
| Vendor Page | Anti COPS8 pAb (ATL-HPA036485) |