Anti COPS8 pAb (ATL-HPA036485)

Atlas Antibodies

Catalog No.:
ATL-HPA036485-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: COP9 signalosome subunit 8
Gene Name: COPS8
Alternative Gene Name: COP9, CSN8, MGC1297, SGN8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034432: 88%, ENSRNOG00000019635: 90%
Entrez Gene ID: 10920
Uniprot ID: Q99627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP
Gene Sequence VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP
Gene ID - Mouse ENSMUSG00000034432
Gene ID - Rat ENSRNOG00000019635
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPS8 pAb (ATL-HPA036485)
Datasheet Anti COPS8 pAb (ATL-HPA036485) Datasheet (External Link)
Vendor Page Anti COPS8 pAb (ATL-HPA036485) at Atlas Antibodies

Documents & Links for Anti COPS8 pAb (ATL-HPA036485)
Datasheet Anti COPS8 pAb (ATL-HPA036485) Datasheet (External Link)
Vendor Page Anti COPS8 pAb (ATL-HPA036485)