Anti COPS7B pAb (ATL-HPA034676)

Atlas Antibodies

Catalog No.:
ATL-HPA034676-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: COP9 signalosome subunit 7B
Gene Name: COPS7B
Alternative Gene Name: CSN7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026240: 96%, ENSRNOG00000018723: 96%
Entrez Gene ID: 64708
Uniprot ID: Q9H9Q2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLV
Gene Sequence EWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLV
Gene ID - Mouse ENSMUSG00000026240
Gene ID - Rat ENSRNOG00000018723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPS7B pAb (ATL-HPA034676)
Datasheet Anti COPS7B pAb (ATL-HPA034676) Datasheet (External Link)
Vendor Page Anti COPS7B pAb (ATL-HPA034676) at Atlas Antibodies

Documents & Links for Anti COPS7B pAb (ATL-HPA034676)
Datasheet Anti COPS7B pAb (ATL-HPA034676) Datasheet (External Link)
Vendor Page Anti COPS7B pAb (ATL-HPA034676)