Anti COPS6 pAb (ATL-HPA044315)

Atlas Antibodies

SKU: ATL-HPA044315-25

• 
• 

Protein Description: COP9 signalosome subunit 6
Gene Name: COPS6
Alternative Gene Name: CSN6, MOV34-34KD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019494: 100%, ENSRNOG00000001346: 100%
Entrez Gene ID: 10980
Uniprot ID: Q7L5N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
• Gene Sequence: EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
• Gene ID - Mouse: ENSMUSG00000019494
• Gene ID - Rat: ENSRNOG00000001346
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.