Anti COPS6 pAb (ATL-HPA044315)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044315-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: COPS6
Alternative Gene Name: CSN6, MOV34-34KD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019494: 100%, ENSRNOG00000001346: 100%
Entrez Gene ID: 10980
Uniprot ID: Q7L5N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM |
| Gene Sequence | EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM |
| Gene ID - Mouse | ENSMUSG00000019494 |
| Gene ID - Rat | ENSRNOG00000001346 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPS6 pAb (ATL-HPA044315) | |
| Datasheet | Anti COPS6 pAb (ATL-HPA044315) Datasheet (External Link) |
| Vendor Page | Anti COPS6 pAb (ATL-HPA044315) at Atlas Antibodies |
| Documents & Links for Anti COPS6 pAb (ATL-HPA044315) | |
| Datasheet | Anti COPS6 pAb (ATL-HPA044315) Datasheet (External Link) |
| Vendor Page | Anti COPS6 pAb (ATL-HPA044315) |