Anti COPS6 pAb (ATL-HPA044315)

Atlas Antibodies

Catalog No.:
ATL-HPA044315-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: COP9 signalosome subunit 6
Gene Name: COPS6
Alternative Gene Name: CSN6, MOV34-34KD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019494: 100%, ENSRNOG00000001346: 100%
Entrez Gene ID: 10980
Uniprot ID: Q7L5N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
Gene Sequence EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
Gene ID - Mouse ENSMUSG00000019494
Gene ID - Rat ENSRNOG00000001346
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPS6 pAb (ATL-HPA044315)
Datasheet Anti COPS6 pAb (ATL-HPA044315) Datasheet (External Link)
Vendor Page Anti COPS6 pAb (ATL-HPA044315) at Atlas Antibodies

Documents & Links for Anti COPS6 pAb (ATL-HPA044315)
Datasheet Anti COPS6 pAb (ATL-HPA044315) Datasheet (External Link)
Vendor Page Anti COPS6 pAb (ATL-HPA044315)