Anti COPS5 pAb (ATL-HPA051531)

Atlas Antibodies

Catalog No.:
ATL-HPA051531-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: COP9 signalosome subunit 5
Gene Name: COPS5
Alternative Gene Name: CSN5, JAB1, MOV-34, SGN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025917: 100%, ENSRNOG00000006499: 100%
Entrez Gene ID: 10987
Uniprot ID: Q92905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
Gene Sequence FQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
Gene ID - Mouse ENSMUSG00000025917
Gene ID - Rat ENSRNOG00000006499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPS5 pAb (ATL-HPA051531)
Datasheet Anti COPS5 pAb (ATL-HPA051531) Datasheet (External Link)
Vendor Page Anti COPS5 pAb (ATL-HPA051531) at Atlas Antibodies

Documents & Links for Anti COPS5 pAb (ATL-HPA051531)
Datasheet Anti COPS5 pAb (ATL-HPA051531) Datasheet (External Link)
Vendor Page Anti COPS5 pAb (ATL-HPA051531)