Anti COPS4 pAb (ATL-HPA042828)

Atlas Antibodies

Catalog No.:
ATL-HPA042828-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: COP9 signalosome subunit 4
Gene Name: COPS4
Alternative Gene Name: CSN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035297: 100%, ENSRNOG00000023650: 100%
Entrez Gene ID: 51138
Uniprot ID: Q9BT78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ
Gene Sequence NITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ
Gene ID - Mouse ENSMUSG00000035297
Gene ID - Rat ENSRNOG00000023650
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPS4 pAb (ATL-HPA042828)
Datasheet Anti COPS4 pAb (ATL-HPA042828) Datasheet (External Link)
Vendor Page Anti COPS4 pAb (ATL-HPA042828) at Atlas Antibodies

Documents & Links for Anti COPS4 pAb (ATL-HPA042828)
Datasheet Anti COPS4 pAb (ATL-HPA042828) Datasheet (External Link)
Vendor Page Anti COPS4 pAb (ATL-HPA042828)