Anti COPS4 pAb (ATL-HPA036894)
Atlas Antibodies
- SKU:
- ATL-HPA036894-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: COPS4
Alternative Gene Name: CSN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035297: 100%, ENSRNOG00000023650: 100%
Entrez Gene ID: 51138
Uniprot ID: Q9BT78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLY |
| Gene Sequence | ALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLY |
| Gene ID - Mouse | ENSMUSG00000035297 |
| Gene ID - Rat | ENSRNOG00000023650 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPS4 pAb (ATL-HPA036894) | |
| Datasheet | Anti COPS4 pAb (ATL-HPA036894) Datasheet (External Link) |
| Vendor Page | Anti COPS4 pAb (ATL-HPA036894) at Atlas Antibodies |
| Documents & Links for Anti COPS4 pAb (ATL-HPA036894) | |
| Datasheet | Anti COPS4 pAb (ATL-HPA036894) Datasheet (External Link) |
| Vendor Page | Anti COPS4 pAb (ATL-HPA036894) |
| Citations for Anti COPS4 pAb (ATL-HPA036894) – 1 Found |
| Lea, Richard G; Amezaga, Maria R; Loup, Benoit; Mandon-Pépin, Béatrice; Stefansdottir, Agnes; Filis, Panagiotis; Kyle, Carol; Zhang, Zulin; Allen, Ceri; Purdie, Laura; Jouneau, Luc; Cotinot, Corinne; Rhind, Stewart M; Sinclair, Kevin D; Fowler, Paul A. The fetal ovary exhibits temporal sensitivity to a 'real-life' mixture of environmental chemicals. Scientific Reports. 2016;6( 26931299):22279. PubMed |