Anti COPS2 pAb (ATL-HPA061071)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061071-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: COPS2
Alternative Gene Name: ALIEN, CSN2, TRIP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027206: 100%, ENSRNOG00000008744: 94%
Entrez Gene ID: 9318
Uniprot ID: P61201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQ |
| Gene Sequence | ISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQ |
| Gene ID - Mouse | ENSMUSG00000027206 |
| Gene ID - Rat | ENSRNOG00000008744 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COPS2 pAb (ATL-HPA061071) | |
| Datasheet | Anti COPS2 pAb (ATL-HPA061071) Datasheet (External Link) |
| Vendor Page | Anti COPS2 pAb (ATL-HPA061071) at Atlas Antibodies |
| Documents & Links for Anti COPS2 pAb (ATL-HPA061071) | |
| Datasheet | Anti COPS2 pAb (ATL-HPA061071) Datasheet (External Link) |
| Vendor Page | Anti COPS2 pAb (ATL-HPA061071) |