Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016867-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: COPS2
Alternative Gene Name: ALIEN, CSN2, TRIP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027206: 100%, ENSRNOG00000008744: 100%
Entrez Gene ID: 9318
Uniprot ID: P61201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMT |
Gene Sequence | KSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMT |
Gene ID - Mouse | ENSMUSG00000027206 |
Gene ID - Rat | ENSRNOG00000008744 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation) | |
Datasheet | Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation) | |
Datasheet | Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation) |
Citations for Anti COPS2 pAb (ATL-HPA016867 w/enhanced validation) – 1 Found |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |