Anti COPRS pAb (ATL-HPA052552)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052552-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: COPRS
Alternative Gene Name: C17orf79, COPR5, HSA272196, TTP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031458: 69%, ENSRNOG00000000111: 66%
Entrez Gene ID: 55352
Uniprot ID: Q9NQ92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE |
Gene Sequence | EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE |
Gene ID - Mouse | ENSMUSG00000031458 |
Gene ID - Rat | ENSRNOG00000000111 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COPRS pAb (ATL-HPA052552) | |
Datasheet | Anti COPRS pAb (ATL-HPA052552) Datasheet (External Link) |
Vendor Page | Anti COPRS pAb (ATL-HPA052552) at Atlas Antibodies |
Documents & Links for Anti COPRS pAb (ATL-HPA052552) | |
Datasheet | Anti COPRS pAb (ATL-HPA052552) Datasheet (External Link) |
Vendor Page | Anti COPRS pAb (ATL-HPA052552) |