Anti COPRS pAb (ATL-HPA052552)

Atlas Antibodies

Catalog No.: ATL-HPA052552-25

Protein Description: coordinator of PRMT5, differentiation stimulator
Gene Name: COPRS
Alternative Gene Name: C17orf79, COPR5, HSA272196, TTP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031458: 69%, ENSRNOG00000000111: 66%
Entrez Gene ID: 55352
Uniprot ID: Q9NQ92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE
• Gene Sequence: EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE
• Gene ID - Mouse: ENSMUSG00000031458
• Gene ID - Rat: ENSRNOG00000000111
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.