Anti COPRS pAb (ATL-HPA052552)

Atlas Antibodies

Catalog No.:
ATL-HPA052552-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coordinator of PRMT5, differentiation stimulator
Gene Name: COPRS
Alternative Gene Name: C17orf79, COPR5, HSA272196, TTP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031458: 69%, ENSRNOG00000000111: 66%
Entrez Gene ID: 55352
Uniprot ID: Q9NQ92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE
Gene Sequence EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE
Gene ID - Mouse ENSMUSG00000031458
Gene ID - Rat ENSRNOG00000000111
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPRS pAb (ATL-HPA052552)
Datasheet Anti COPRS pAb (ATL-HPA052552) Datasheet (External Link)
Vendor Page Anti COPRS pAb (ATL-HPA052552) at Atlas Antibodies

Documents & Links for Anti COPRS pAb (ATL-HPA052552)
Datasheet Anti COPRS pAb (ATL-HPA052552) Datasheet (External Link)
Vendor Page Anti COPRS pAb (ATL-HPA052552)