Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037866-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coatomer protein complex, subunit gamma 1
Gene Name: COPG1
Alternative Gene Name: COPG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030058: 99%, ENSRNOG00000010474: 99%
Entrez Gene ID: 22820
Uniprot ID: Q9Y678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL
Gene Sequence MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL
Gene ID - Mouse ENSMUSG00000030058
Gene ID - Rat ENSRNOG00000010474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation)
Datasheet Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation)
Datasheet Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation)
Citations for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) – 1 Found
Kaeser-Pebernard, Stéphanie; Vionnet, Christine; Mari, Muriel; Sankar, Devanarayanan Siva; Hu, Zehan; Roubaty, Carole; Martínez-Martínez, Esther; Zhao, Huiyuan; Spuch-Calvar, Miguel; Petri-Fink, Alke; Rainer, Gregor; Steinberg, Florian; Reggiori, Fulvio; Dengjel, Jörn. mTORC1 controls Golgi architecture and vesicle secretion by phosphorylation of SCYL1. Nature Communications. 2022;13(1):4685.  PubMed