Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037866-25

Protein Description: coatomer protein complex, subunit gamma 1
Gene Name: COPG1
Alternative Gene Name: COPG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030058: 99%, ENSRNOG00000010474: 99%
Entrez Gene ID: 22820
Uniprot ID: Q9Y678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL
• Gene Sequence: MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL
• Gene ID - Mouse: ENSMUSG00000030058
• Gene ID - Rat: ENSRNOG00000010474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COPG1 pAb (ATL-HPA037866 w/enhanced validation) – 1 Found

Kaeser-Pebernard, Stéphanie; Vionnet, Christine; Mari, Muriel; Sankar, Devanarayanan Siva; Hu, Zehan; Roubaty, Carole; Martínez-Martínez, Esther; Zhao, Huiyuan; Spuch-Calvar, Miguel; Petri-Fink, Alke; Rainer, Gregor; Steinberg, Florian; Reggiori, Fulvio; Dengjel, Jörn. mTORC1 controls Golgi architecture and vesicle secretion by phosphorylation of SCYL1. Nature Communications. 2022;13(1):4685.