Anti COPE pAb (ATL-HPA043576)

Atlas Antibodies

SKU: ATL-HPA043576-100

• 
• 
• 

Protein Description: coatomer protein complex, subunit epsilon
Gene Name: COPE
Alternative Gene Name: epsilon-COP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055681: 96%, ENSRNOG00000020178: 95%
Entrez Gene ID: 11316
Uniprot ID: O14579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYL
• Gene Sequence: GSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYL
• Gene ID - Mouse: ENSMUSG00000055681
• Gene ID - Rat: ENSRNOG00000020178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.