Anti COPE pAb (ATL-HPA041605)

Atlas Antibodies

Catalog No.:
ATL-HPA041605-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: coatomer protein complex, subunit epsilon
Gene Name: COPE
Alternative Gene Name: epsilon-COP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055681: 89%, ENSRNOG00000020178: 89%
Entrez Gene ID: 11316
Uniprot ID: O14579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNL
Gene Sequence DATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNL
Gene ID - Mouse ENSMUSG00000055681
Gene ID - Rat ENSRNOG00000020178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPE pAb (ATL-HPA041605)
Datasheet Anti COPE pAb (ATL-HPA041605) Datasheet (External Link)
Vendor Page Anti COPE pAb (ATL-HPA041605) at Atlas Antibodies

Documents & Links for Anti COPE pAb (ATL-HPA041605)
Datasheet Anti COPE pAb (ATL-HPA041605) Datasheet (External Link)
Vendor Page Anti COPE pAb (ATL-HPA041605)