Anti COPB2 pAb (ATL-HPA058180)

Atlas Antibodies

SKU:
ATL-HPA058180-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coatomer protein complex, subunit beta 2 (beta prime)
Gene Name: COPB2
Alternative Gene Name: beta'-COP, betaprime-COP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032458: 98%, ENSRNOG00000060723: 26%
Entrez Gene ID: 9276
Uniprot ID: P35606
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
Gene Sequence GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
Gene ID - Mouse ENSMUSG00000032458
Gene ID - Rat ENSRNOG00000060723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COPB2 pAb (ATL-HPA058180)
Datasheet Anti COPB2 pAb (ATL-HPA058180) Datasheet (External Link)
Vendor Page Anti COPB2 pAb (ATL-HPA058180) at Atlas Antibodies

Documents & Links for Anti COPB2 pAb (ATL-HPA058180)
Datasheet Anti COPB2 pAb (ATL-HPA058180) Datasheet (External Link)
Vendor Page Anti COPB2 pAb (ATL-HPA058180)