Anti COPB2 pAb (ATL-HPA058180)

Atlas Antibodies

SKU: ATL-HPA058180-25

• 

Protein Description: coatomer protein complex, subunit beta 2 (beta prime)
Gene Name: COPB2
Alternative Gene Name: beta'-COP, betaprime-COP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032458: 98%, ENSRNOG00000060723: 26%
Entrez Gene ID: 9276
Uniprot ID: P35606
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
• Gene Sequence: GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
• Gene ID - Mouse: ENSMUSG00000032458
• Gene ID - Rat: ENSRNOG00000060723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.