Anti COPB1 pAb (ATL-HPA064403)

Atlas Antibodies

Catalog No.:
ATL-HPA064403-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: coatomer protein complex, subunit beta 1
Gene Name: COPB1
Alternative Gene Name: COPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030754: 98%, ENSRNOG00000057623: 97%
Entrez Gene ID: 1315
Uniprot ID: P53618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
Gene Sequence NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
Gene ID - Mouse ENSMUSG00000030754
Gene ID - Rat ENSRNOG00000057623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COPB1 pAb (ATL-HPA064403)
Datasheet Anti COPB1 pAb (ATL-HPA064403) Datasheet (External Link)
Vendor Page Anti COPB1 pAb (ATL-HPA064403) at Atlas Antibodies

Documents & Links for Anti COPB1 pAb (ATL-HPA064403)
Datasheet Anti COPB1 pAb (ATL-HPA064403) Datasheet (External Link)
Vendor Page Anti COPB1 pAb (ATL-HPA064403)