Anti COPB1 pAb (ATL-HPA064403)

Atlas Antibodies

Catalog No.: ATL-HPA064403-100

Protein Description: coatomer protein complex, subunit beta 1
Gene Name: COPB1
Alternative Gene Name: COPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030754: 98%, ENSRNOG00000057623: 97%
Entrez Gene ID: 1315
Uniprot ID: P53618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
• Gene Sequence: NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
• Gene ID - Mouse: ENSMUSG00000030754
• Gene ID - Rat: ENSRNOG00000057623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.