Anti COPB1 pAb (ATL-HPA043954)

Atlas Antibodies

SKU:
ATL-HPA043954-25
  • Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coatomer protein complex, subunit beta 1
Gene Name: COPB1
Alternative Gene Name: COPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030754: 100%, ENSRNOG00000057623: 100%
Entrez Gene ID: 1315
Uniprot ID: P53618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMW
Gene Sequence VLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMW
Gene ID - Mouse ENSMUSG00000030754
Gene ID - Rat ENSRNOG00000057623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COPB1 pAb (ATL-HPA043954)
Datasheet Anti COPB1 pAb (ATL-HPA043954) Datasheet (External Link)
Vendor Page Anti COPB1 pAb (ATL-HPA043954) at Atlas Antibodies

Documents & Links for Anti COPB1 pAb (ATL-HPA043954)
Datasheet Anti COPB1 pAb (ATL-HPA043954) Datasheet (External Link)
Vendor Page Anti COPB1 pAb (ATL-HPA043954)