Anti COMTD1 pAb (ATL-HPA042165 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042165-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and COMTD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408263).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: catechol-O-methyltransferase domain containing 1
Gene Name: COMTD1
Alternative Gene Name: FLJ23841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021773: 83%, ENSRNOG00000013968: 84%
Entrez Gene ID: 118881
Uniprot ID: Q86VU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVY
Gene Sequence ETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVY
Gene ID - Mouse ENSMUSG00000021773
Gene ID - Rat ENSRNOG00000013968
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti COMTD1 pAb (ATL-HPA042165 w/enhanced validation)
Datasheet Anti COMTD1 pAb (ATL-HPA042165 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COMTD1 pAb (ATL-HPA042165 w/enhanced validation)