Anti COMT pAb (ATL-HPA001169 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001169-100
  • Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell lines MCF-7 and PC-3 using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Protein Description: catechol-O-methyltransferase
Gene Name: COMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098892: 82%, ENSRNOG00000001889: 82%
Entrez Gene ID: 1312
Uniprot ID: P21964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIY
Gene Sequence YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIY
Gene ID - Mouse ENSMUSG00000098892
Gene ID - Rat ENSRNOG00000001889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COMT pAb (ATL-HPA001169 w/enhanced validation)
Datasheet Anti COMT pAb (ATL-HPA001169 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COMT pAb (ATL-HPA001169 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COMT pAb (ATL-HPA001169 w/enhanced validation)
Datasheet Anti COMT pAb (ATL-HPA001169 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COMT pAb (ATL-HPA001169 w/enhanced validation)



Citations for Anti COMT pAb (ATL-HPA001169 w/enhanced validation) – 1 Found
Hirata, Hiroshi; Hinoda, Yuji; Okayama, Naoko; Suehiro, Yutaka; Kawamoto, Ken; Kikuno, Nobuyuki; Rabban, Joseph T; Chen, Lee-May; Dahiya, Rajvir. COMT polymorphisms affecting protein expression are risk factors for endometrial cancer. Molecular Carcinogenesis. 2008;47(10):768-74.  PubMed