Anti COMMD2 pAb (ATL-HPA044190)

Atlas Antibodies

Catalog No.: ATL-HPA044190-25

Protein Description: COMM domain containing 2
Gene Name: COMMD2
Alternative Gene Name: HSPC042
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036513: 92%, ENSRNOG00000043386: 90%
Entrez Gene ID: 51122
Uniprot ID: Q86X83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALE
• Gene Sequence: FVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALE
• Gene ID - Mouse: ENSMUSG00000036513
• Gene ID - Rat: ENSRNOG00000043386
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.