Anti COMMD10 pAb (ATL-HPA054156)

Atlas Antibodies

Catalog No.:
ATL-HPA054156-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: COMM domain containing 10
Gene Name: COMMD10
Alternative Gene Name: PTD002
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042705: 86%, ENSRNOG00000003958: 84%
Entrez Gene ID: 51397
Uniprot ID: Q9Y6G5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQ
Gene Sequence SLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQ
Gene ID - Mouse ENSMUSG00000042705
Gene ID - Rat ENSRNOG00000003958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COMMD10 pAb (ATL-HPA054156)
Datasheet Anti COMMD10 pAb (ATL-HPA054156) Datasheet (External Link)
Vendor Page Anti COMMD10 pAb (ATL-HPA054156) at Atlas Antibodies

Documents & Links for Anti COMMD10 pAb (ATL-HPA054156)
Datasheet Anti COMMD10 pAb (ATL-HPA054156) Datasheet (External Link)
Vendor Page Anti COMMD10 pAb (ATL-HPA054156)