Anti COMMD1 pAb (ATL-HPA034633)

Atlas Antibodies

SKU:
ATL-HPA034633-25
  • Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: copper metabolism (Murr1) domain containing 1
Gene Name: COMMD1
Alternative Gene Name: C2orf5, MGC27155, MURR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051355: 89%, ENSRNOG00000009281: 92%
Entrez Gene ID: 150684
Uniprot ID: Q8N668
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAV
Gene Sequence AQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAV
Gene ID - Mouse ENSMUSG00000051355
Gene ID - Rat ENSRNOG00000009281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COMMD1 pAb (ATL-HPA034633)
Datasheet Anti COMMD1 pAb (ATL-HPA034633) Datasheet (External Link)
Vendor Page Anti COMMD1 pAb (ATL-HPA034633) at Atlas Antibodies

Documents & Links for Anti COMMD1 pAb (ATL-HPA034633)
Datasheet Anti COMMD1 pAb (ATL-HPA034633) Datasheet (External Link)
Vendor Page Anti COMMD1 pAb (ATL-HPA034633)