Anti COLGALT2 pAb (ATL-HPA031749 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA031749-25
  • Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus.
  • Western blot analysis using Anti-COLGALT2 antibody HPA031749 (A) shows similar pattern to independent antibody HPA031750 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: collagen beta(1-O)galactosyltransferase 2
Gene Name: COLGALT2
Alternative Gene Name: C1orf17, GLT25D2, KIAA0584
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032649: 95%, ENSRNOG00000028207: 96%
Entrez Gene ID: 23127
Uniprot ID: Q8IYK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEI
Gene Sequence AFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEI
Gene ID - Mouse ENSMUSG00000032649
Gene ID - Rat ENSRNOG00000028207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti COLGALT2 pAb (ATL-HPA031749 w/enhanced validation)
Datasheet Anti COLGALT2 pAb (ATL-HPA031749 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COLGALT2 pAb (ATL-HPA031749 w/enhanced validation)