Anti COLGALT1 pAb (ATL-HPA047821)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047821-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: COLGALT1
Alternative Gene Name: FLJ22329, GLT25D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034807: 90%, ENSRNOG00000023317: 88%
Entrez Gene ID: 79709
Uniprot ID: Q8NBJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPD |
Gene Sequence | FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPD |
Gene ID - Mouse | ENSMUSG00000034807 |
Gene ID - Rat | ENSRNOG00000023317 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COLGALT1 pAb (ATL-HPA047821) | |
Datasheet | Anti COLGALT1 pAb (ATL-HPA047821) Datasheet (External Link) |
Vendor Page | Anti COLGALT1 pAb (ATL-HPA047821) at Atlas Antibodies |
Documents & Links for Anti COLGALT1 pAb (ATL-HPA047821) | |
Datasheet | Anti COLGALT1 pAb (ATL-HPA047821) Datasheet (External Link) |
Vendor Page | Anti COLGALT1 pAb (ATL-HPA047821) |