Anti COLEC11 pAb (ATL-HPA035241)

Atlas Antibodies

SKU:
ATL-HPA035241-25
  • Immunohistochemical staining of human liver shows cytoplasmic positivity in hepatocytes and nuclear in sinusoids.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: collectin sub-family member 11
Gene Name: COLEC11
Alternative Gene Name: CL-K1, MGC3279
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036655: 94%, ENSRNOG00000008373: 93%
Entrez Gene ID: 78989
Uniprot ID: Q9BWP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Gene Sequence INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Gene ID - Mouse ENSMUSG00000036655
Gene ID - Rat ENSRNOG00000008373
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COLEC11 pAb (ATL-HPA035241)
Datasheet Anti COLEC11 pAb (ATL-HPA035241) Datasheet (External Link)
Vendor Page Anti COLEC11 pAb (ATL-HPA035241) at Atlas Antibodies

Documents & Links for Anti COLEC11 pAb (ATL-HPA035241)
Datasheet Anti COLEC11 pAb (ATL-HPA035241) Datasheet (External Link)
Vendor Page Anti COLEC11 pAb (ATL-HPA035241)



Citations for Anti COLEC11 pAb (ATL-HPA035241) – 1 Found
Man-Kupisinska, Aleksandra; Michalski, Mateusz; Maciejewska, Anna; Swierzko, Anna S; Cedzynski, Maciej; Lugowski, Czeslaw; Lukasiewicz, Jolanta. A New Ligand-Based Method for Purifying Active Human Plasma-Derived Ficolin-3 Complexes Supports the Phenomenon of Crosstalk between Pattern-Recognition Molecules and Immunoglobulins. Plos One. 11(5):e0156691.  PubMed