Anti COL9A2 pAb (ATL-HPA075286)

Atlas Antibodies

Catalog No.: ATL-HPA075286-100

Protein Description: collagen type IX alpha 2 chain
Gene Name: COL9A2
Alternative Gene Name: EDM2, MED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028626: 83%, ENSRNOG00000011502: 83%
Entrez Gene ID: 1298
Uniprot ID: Q14055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGVPGQPGRQGVEGRDATDQHIVDVALKML
• Gene Sequence: RGVPGQPGRQGVEGRDATDQHIVDVALKML
• Gene ID - Mouse: ENSMUSG00000028626
• Gene ID - Rat: ENSRNOG00000011502
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.