Anti COL9A2 pAb (ATL-HPA056316)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056316-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: COL9A2
Alternative Gene Name: EDM2, MED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028626: 92%, ENSRNOG00000011502: 92%
Entrez Gene ID: 1298
Uniprot ID: Q14055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGV |
| Gene Sequence | PGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGV |
| Gene ID - Mouse | ENSMUSG00000028626 |
| Gene ID - Rat | ENSRNOG00000011502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL9A2 pAb (ATL-HPA056316) | |
| Datasheet | Anti COL9A2 pAb (ATL-HPA056316) Datasheet (External Link) |
| Vendor Page | Anti COL9A2 pAb (ATL-HPA056316) at Atlas Antibodies |
| Documents & Links for Anti COL9A2 pAb (ATL-HPA056316) | |
| Datasheet | Anti COL9A2 pAb (ATL-HPA056316) Datasheet (External Link) |
| Vendor Page | Anti COL9A2 pAb (ATL-HPA056316) |
| Citations for Anti COL9A2 pAb (ATL-HPA056316) – 1 Found |
| Hartman, Byron H; Durruthy-Durruthy, Robert; Laske, Roman D; Losorelli, Steven; Heller, Stefan. Identification and characterization of mouse otic sensory lineage genes. Frontiers In Cellular Neuroscience. 9( 25852475):79. PubMed |