Anti COL9A2 pAb (ATL-HPA056316)

Atlas Antibodies

Catalog No.:
ATL-HPA056316-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: collagen, type IX, alpha 2
Gene Name: COL9A2
Alternative Gene Name: EDM2, MED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028626: 92%, ENSRNOG00000011502: 92%
Entrez Gene ID: 1298
Uniprot ID: Q14055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGV
Gene Sequence PGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGV
Gene ID - Mouse ENSMUSG00000028626
Gene ID - Rat ENSRNOG00000011502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COL9A2 pAb (ATL-HPA056316)
Datasheet Anti COL9A2 pAb (ATL-HPA056316) Datasheet (External Link)
Vendor Page Anti COL9A2 pAb (ATL-HPA056316) at Atlas Antibodies

Documents & Links for Anti COL9A2 pAb (ATL-HPA056316)
Datasheet Anti COL9A2 pAb (ATL-HPA056316) Datasheet (External Link)
Vendor Page Anti COL9A2 pAb (ATL-HPA056316)
Citations for Anti COL9A2 pAb (ATL-HPA056316) – 1 Found
Hartman, Byron H; Durruthy-Durruthy, Robert; Laske, Roman D; Losorelli, Steven; Heller, Stefan. Identification and characterization of mouse otic sensory lineage genes. Frontiers In Cellular Neuroscience. 9( 25852475):79.  PubMed