Anti COL6A3 pAb (ATL-HPA010080)

Atlas Antibodies

Catalog No.:
ATL-HPA010080-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: collagen, type VI, alpha 3
Gene Name: COL6A3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048126: 85%, ENSRNOG00000031782: 23%
Entrez Gene ID: 1293
Uniprot ID: P12111
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Gene Sequence PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Gene ID - Mouse ENSMUSG00000048126
Gene ID - Rat ENSRNOG00000031782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COL6A3 pAb (ATL-HPA010080)
Datasheet Anti COL6A3 pAb (ATL-HPA010080) Datasheet (External Link)
Vendor Page Anti COL6A3 pAb (ATL-HPA010080) at Atlas Antibodies

Documents & Links for Anti COL6A3 pAb (ATL-HPA010080)
Datasheet Anti COL6A3 pAb (ATL-HPA010080) Datasheet (External Link)
Vendor Page Anti COL6A3 pAb (ATL-HPA010080)
Citations for Anti COL6A3 pAb (ATL-HPA010080) – 1 Found
Marrosu, Elena; Ala, Pierpaolo; Muntoni, Francesco; Zhou, Haiyan. Gapmer Antisense Oligonucleotides Suppress the Mutant Allele of COL6A3 and Restore Functional Protein in Ullrich Muscular Dystrophy. Molecular Therapy. Nucleic Acids. 2017;8( 28918041):416-427.  PubMed