Anti COL6A3 pAb (ATL-HPA010080)

Atlas Antibodies

Catalog No.: ATL-HPA010080-100

Protein Description: collagen, type VI, alpha 3
Gene Name: COL6A3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048126: 85%, ENSRNOG00000031782: 23%
Entrez Gene ID: 1293
Uniprot ID: P12111
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
• Gene Sequence: PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
• Gene ID - Mouse: ENSMUSG00000048126
• Gene ID - Rat: ENSRNOG00000031782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COL6A3 pAb (ATL-HPA010080) – 1 Found

Marrosu, Elena; Ala, Pierpaolo; Muntoni, Francesco; Zhou, Haiyan. Gapmer Antisense Oligonucleotides Suppress the Mutant Allele of COL6A3 and Restore Functional Protein in Ullrich Muscular Dystrophy. Molecular Therapy. Nucleic Acids. 2017;8( 28918041):416-427.