Anti COL6A3 pAb (ATL-HPA010080)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010080-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: COL6A3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048126: 85%, ENSRNOG00000031782: 23%
Entrez Gene ID: 1293
Uniprot ID: P12111
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT |
Gene Sequence | PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT |
Gene ID - Mouse | ENSMUSG00000048126 |
Gene ID - Rat | ENSRNOG00000031782 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COL6A3 pAb (ATL-HPA010080) | |
Datasheet | Anti COL6A3 pAb (ATL-HPA010080) Datasheet (External Link) |
Vendor Page | Anti COL6A3 pAb (ATL-HPA010080) at Atlas Antibodies |
Documents & Links for Anti COL6A3 pAb (ATL-HPA010080) | |
Datasheet | Anti COL6A3 pAb (ATL-HPA010080) Datasheet (External Link) |
Vendor Page | Anti COL6A3 pAb (ATL-HPA010080) |
Citations for Anti COL6A3 pAb (ATL-HPA010080) – 1 Found |
Marrosu, Elena; Ala, Pierpaolo; Muntoni, Francesco; Zhou, Haiyan. Gapmer Antisense Oligonucleotides Suppress the Mutant Allele of COL6A3 and Restore Functional Protein in Ullrich Muscular Dystrophy. Molecular Therapy. Nucleic Acids. 2017;8( 28918041):416-427. PubMed |