Anti COL6A2 pAb (ATL-HPA007029 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007029-25

• 

Protein Description: collagen, type VI, alpha 2
Gene Name: COL6A2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020241: 89%, ENSRNOG00000001254: 88%
Entrez Gene ID: 1292
Uniprot ID: P12110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALANMTEQIRQDR
• Gene Sequence: TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALANMTEQIRQDR
• Gene ID - Mouse: ENSMUSG00000020241
• Gene ID - Rat: ENSRNOG00000001254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COL6A2 pAb (ATL-HPA007029 w/enhanced validation) – 2 Found

Ghosh, Zhumur; Huang, Mei; Hu, Shijun; Wilson, Kitchener D; Dey, Devaveena; Wu, Joseph C. Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells. Cancer Research. 2011;71(14):5030-9. 

Liu, Yang; Carson-Walter, Eleanor B; Cooper, Anna; Winans, Bethany N; Johnson, Mahlon D; Walter, Kevin A. Vascular gene expression patterns are conserved in primary and metastatic brain tumors. Journal Of Neuro-Oncology. 2010;99(1):13-24.