Anti COL5A1 pAb (ATL-HPA030769)

Atlas Antibodies

SKU:
ATL-HPA030769-25
  • Immunohistochemical staining of human urinary bladder shows distinct positivity positivity in connective tissue.
  • Immunofluorescent staining of human cell line HeLa shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: collagen, type V, alpha 1
Gene Name: COL5A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026837: 72%, ENSRNOG00000008749: 76%
Entrez Gene ID: 1289
Uniprot ID: P20908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVEAAKETTEVPEELTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTYGEGEENPDQPTDPGAGAEIPTSTADTSNSSNPAPPPGEGADDLEGEFTEETIRNLDENYYDPYYDPTSSPSEIGPGMPANQDTIYE
Gene Sequence PVEAAKETTEVPEELTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTYGEGEENPDQPTDPGAGAEIPTSTADTSNSSNPAPPPGEGADDLEGEFTEETIRNLDENYYDPYYDPTSSPSEIGPGMPANQDTIYE
Gene ID - Mouse ENSMUSG00000026837
Gene ID - Rat ENSRNOG00000008749
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COL5A1 pAb (ATL-HPA030769)
Datasheet Anti COL5A1 pAb (ATL-HPA030769) Datasheet (External Link)
Vendor Page Anti COL5A1 pAb (ATL-HPA030769) at Atlas Antibodies

Documents & Links for Anti COL5A1 pAb (ATL-HPA030769)
Datasheet Anti COL5A1 pAb (ATL-HPA030769) Datasheet (External Link)
Vendor Page Anti COL5A1 pAb (ATL-HPA030769)



Citations for Anti COL5A1 pAb (ATL-HPA030769) – 1 Found
Wu, Mei; Sun, Qi; Mo, Chao-Hua; Pang, Jin-Shu; Hou, Jia-Yin; Pang, Ling-Ling; Lu, Hui-Ping; Dang, Yi-Wu; Fang, Su-Jie; Tang, Deng; Chen, Gang; Feng, Zhen-Bo. Prospective molecular mechanism of COL5A1 in breast cancer based on a microarray, RNA sequencing and immunohistochemistry. Oncology Reports. 2019;42(1):151-175.  PubMed