Anti COL4A6 pAb (ATL-HPA065393)
Atlas Antibodies
- SKU:
- ATL-HPA065393-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: COL4A6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031273: 53%, ENSRNOG00000056772: 53%
Entrez Gene ID: 1288
Uniprot ID: Q14031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV |
Gene Sequence | EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV |
Gene ID - Mouse | ENSMUSG00000031273 |
Gene ID - Rat | ENSRNOG00000056772 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COL4A6 pAb (ATL-HPA065393) | |
Datasheet | Anti COL4A6 pAb (ATL-HPA065393) Datasheet (External Link) |
Vendor Page | Anti COL4A6 pAb (ATL-HPA065393) at Atlas Antibodies |
Documents & Links for Anti COL4A6 pAb (ATL-HPA065393) | |
Datasheet | Anti COL4A6 pAb (ATL-HPA065393) Datasheet (External Link) |
Vendor Page | Anti COL4A6 pAb (ATL-HPA065393) |