Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007583-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: COL3A1
Alternative Gene Name: EDS4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026043: 93%, ENSRNOG00000003357: 91%
Entrez Gene ID: 1281
Uniprot ID: P02461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
Gene Sequence | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
Gene ID - Mouse | ENSMUSG00000026043 |
Gene ID - Rat | ENSRNOG00000003357 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) | |
Datasheet | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) | |
Datasheet | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) |
Citations for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) – 3 Found |
Gao, Yuan-Feng; Zhu, Tao; Chen, Juan; Liu, Lin; Ouyang, Rong. Knockdown of collagen α-1(III) inhibits glioma cell proliferation and migration and is regulated by miR128-3p. Oncology Letters. 2018;16(2):1917-1923. PubMed |
Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Nemes, Szilárd; Werner Rönnerman, Elisabeth; De Lara, Shahin; Biermann, Jana; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Immunohistochemical validation of COL3A1, GPR158 and PITHD1 as prognostic biomarkers in early-stage ovarian carcinomas. Bmc Cancer. 2019;19(1):928. PubMed |
Davaadelger, Batzaya; Choi, Mi-Ran; Singhal, Hari; Clare, Susan E; Khan, Seema A; Kim, J Julie. BRCA1 mutation influences progesterone response in human benign mammary organoids. Breast Cancer Research : Bcr. 2019;21(1):124. PubMed |