Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA007583-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: collagen, type III, alpha 1
Gene Name: COL3A1
Alternative Gene Name: EDS4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026043: 93%, ENSRNOG00000003357: 91%
Entrez Gene ID: 1281
Uniprot ID: P02461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Gene Sequence RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Gene ID - Mouse ENSMUSG00000026043
Gene ID - Rat ENSRNOG00000003357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation)
Datasheet Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation)
Datasheet Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation)
Citations for Anti COL3A1 pAb (ATL-HPA007583 w/enhanced validation) – 3 Found
Gao, Yuan-Feng; Zhu, Tao; Chen, Juan; Liu, Lin; Ouyang, Rong. Knockdown of collagen α-1(III) inhibits glioma cell proliferation and migration and is regulated by miR128-3p. Oncology Letters. 2018;16(2):1917-1923.  PubMed
Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Nemes, Szilárd; Werner Rönnerman, Elisabeth; De Lara, Shahin; Biermann, Jana; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Immunohistochemical validation of COL3A1, GPR158 and PITHD1 as prognostic biomarkers in early-stage ovarian carcinomas. Bmc Cancer. 2019;19(1):928.  PubMed
Davaadelger, Batzaya; Choi, Mi-Ran; Singhal, Hari; Clare, Susan E; Khan, Seema A; Kim, J Julie. BRCA1 mutation influences progesterone response in human benign mammary organoids. Breast Cancer Research : Bcr. 2019;21(1):124.  PubMed