Anti COL28A1 pAb (ATL-HPA043844)

Atlas Antibodies

SKU:
ATL-HPA043844-25
  • Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: collagen type XXVIII alpha 1 chain
Gene Name: COL28A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068794: 57%, ENSRNOG00000033618: 58%
Entrez Gene ID: 340267
Uniprot ID: Q2UY09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET
Gene Sequence SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET
Gene ID - Mouse ENSMUSG00000068794
Gene ID - Rat ENSRNOG00000033618
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COL28A1 pAb (ATL-HPA043844)
Datasheet Anti COL28A1 pAb (ATL-HPA043844) Datasheet (External Link)
Vendor Page Anti COL28A1 pAb (ATL-HPA043844) at Atlas Antibodies

Documents & Links for Anti COL28A1 pAb (ATL-HPA043844)
Datasheet Anti COL28A1 pAb (ATL-HPA043844) Datasheet (External Link)
Vendor Page Anti COL28A1 pAb (ATL-HPA043844)