Anti COL28A1 pAb (ATL-HPA043844)

Atlas Antibodies

Catalog No.: ATL-HPA043844-25

Protein Description: collagen type XXVIII alpha 1 chain
Gene Name: COL28A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068794: 57%, ENSRNOG00000033618: 58%
Entrez Gene ID: 340267
Uniprot ID: Q2UY09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET
• Gene Sequence: SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET
• Gene ID - Mouse: ENSMUSG00000068794
• Gene ID - Rat: ENSRNOG00000033618
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.