Anti COL26A1 pAb (ATL-HPA027059)

Atlas Antibodies

SKU:
ATL-HPA027059-25
  • Immunohistochemical staining of human vagina shows distinct positivity in extracellular matrix.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: collagen, type XXVI, alpha 1
Gene Name: COL26A1
Alternative Gene Name: EMI6, EMID2, Emu2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004415: 92%, ENSRNOG00000001422: 75%
Entrez Gene ID: 136227
Uniprot ID: Q96A83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP
Gene Sequence ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP
Gene ID - Mouse ENSMUSG00000004415
Gene ID - Rat ENSRNOG00000001422
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COL26A1 pAb (ATL-HPA027059)
Datasheet Anti COL26A1 pAb (ATL-HPA027059) Datasheet (External Link)
Vendor Page Anti COL26A1 pAb (ATL-HPA027059) at Atlas Antibodies

Documents & Links for Anti COL26A1 pAb (ATL-HPA027059)
Datasheet Anti COL26A1 pAb (ATL-HPA027059) Datasheet (External Link)
Vendor Page Anti COL26A1 pAb (ATL-HPA027059)