Anti COL22A1 pAb (ATL-HPA024830)

Atlas Antibodies

SKU:
ATL-HPA024830-25
  • Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: collagen, type XXII, alpha 1
Gene Name: COL22A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079022: 99%, ENSRNOG00000024824: 99%
Entrez Gene ID: 169044
Uniprot ID: Q8NFW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKEELEEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGGTKEITGFDLMDLFSVKEILGKRENGAQSSYVRMG
Gene Sequence LKEELEEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGGTKEITGFDLMDLFSVKEILGKRENGAQSSYVRMG
Gene ID - Mouse ENSMUSG00000079022
Gene ID - Rat ENSRNOG00000024824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COL22A1 pAb (ATL-HPA024830)
Datasheet Anti COL22A1 pAb (ATL-HPA024830) Datasheet (External Link)
Vendor Page Anti COL22A1 pAb (ATL-HPA024830) at Atlas Antibodies

Documents & Links for Anti COL22A1 pAb (ATL-HPA024830)
Datasheet Anti COL22A1 pAb (ATL-HPA024830) Datasheet (External Link)
Vendor Page Anti COL22A1 pAb (ATL-HPA024830)