Anti COL1A1 pAb (ATL-HPA008405)

Atlas Antibodies

Catalog No.: ATL-HPA008405-25

Protein Description: collagen, type I, alpha 1
Gene Name: COL1A1
Alternative Gene Name: OI4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001506: 90%, ENSRNOG00000003897: 91%
Entrez Gene ID: 1277
Uniprot ID: P02452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK
• Gene Sequence: NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK
• Gene ID - Mouse: ENSMUSG00000001506
• Gene ID - Rat: ENSRNOG00000003897
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COL1A1 pAb (ATL-HPA008405) – 2 Found

Doan, Ngoc-Duc; Hosseini, Azade S; Bikovtseva, Agata A; Huang, Michelle S; DiChiara, Andrew S; Papa, Louis J 3rd; Koller, Antonius; Shoulders, Matthew D. Elucidation of proteostasis defects caused by osteogenesis imperfecta mutations in the collagen-α2(I) C-propeptide domain. The Journal Of Biological Chemistry. 2020;295(29):9959-9973. 

Stojanović, Stevan D; Fuchs, Maximilian; Fiedler, Jan; Xiao, Ke; Meinecke, Anna; Just, Annette; Pich, Andreas; Thum, Thomas; Kunz, Meik. Comprehensive Bioinformatics Identifies Key microRNA Players in ATG7-Deficient Lung Fibroblasts. International Journal Of Molecular Sciences. 2020;21(11)