Anti COL1A1 pAb (ATL-HPA008405)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008405-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: COL1A1
Alternative Gene Name: OI4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001506: 90%, ENSRNOG00000003897: 91%
Entrez Gene ID: 1277
Uniprot ID: P02452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK |
| Gene Sequence | NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK |
| Gene ID - Mouse | ENSMUSG00000001506 |
| Gene ID - Rat | ENSRNOG00000003897 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL1A1 pAb (ATL-HPA008405) | |
| Datasheet | Anti COL1A1 pAb (ATL-HPA008405) Datasheet (External Link) |
| Vendor Page | Anti COL1A1 pAb (ATL-HPA008405) at Atlas Antibodies |
| Documents & Links for Anti COL1A1 pAb (ATL-HPA008405) | |
| Datasheet | Anti COL1A1 pAb (ATL-HPA008405) Datasheet (External Link) |
| Vendor Page | Anti COL1A1 pAb (ATL-HPA008405) |
| Citations for Anti COL1A1 pAb (ATL-HPA008405) – 2 Found |
| Doan, Ngoc-Duc; Hosseini, Azade S; Bikovtseva, Agata A; Huang, Michelle S; DiChiara, Andrew S; Papa, Louis J 3rd; Koller, Antonius; Shoulders, Matthew D. Elucidation of proteostasis defects caused by osteogenesis imperfecta mutations in the collagen-α2(I) C-propeptide domain. The Journal Of Biological Chemistry. 2020;295(29):9959-9973. PubMed |
| Stojanović, Stevan D; Fuchs, Maximilian; Fiedler, Jan; Xiao, Ke; Meinecke, Anna; Just, Annette; Pich, Andreas; Thum, Thomas; Kunz, Meik. Comprehensive Bioinformatics Identifies Key microRNA Players in ATG7-Deficient Lung Fibroblasts. International Journal Of Molecular Sciences. 2020;21(11) PubMed |