Anti COL19A1 pAb (ATL-HPA042422)

Atlas Antibodies

SKU:
ATL-HPA042422-25
  • Immunohistochemical staining of human urinary bladder shows strong membrane and cytoplasmic positivity in urothelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: collagen, type XIX, alpha 1
Gene Name: COL19A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026141: 72%, ENSRNOG00000012759: 70%
Entrez Gene ID: 1310
Uniprot ID: Q14993
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTVRDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKKERWFLWQVL
Gene Sequence VTVRDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKKERWFLWQVL
Gene ID - Mouse ENSMUSG00000026141
Gene ID - Rat ENSRNOG00000012759
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COL19A1 pAb (ATL-HPA042422)
Datasheet Anti COL19A1 pAb (ATL-HPA042422) Datasheet (External Link)
Vendor Page Anti COL19A1 pAb (ATL-HPA042422) at Atlas Antibodies

Documents & Links for Anti COL19A1 pAb (ATL-HPA042422)
Datasheet Anti COL19A1 pAb (ATL-HPA042422) Datasheet (External Link)
Vendor Page Anti COL19A1 pAb (ATL-HPA042422)