Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043673-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: COL17A1
Alternative Gene Name: BP180, BPAG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025064: 92%, ENSRNOG00000012110: 92%
Entrez Gene ID: 1308
Uniprot ID: Q9UMD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR |
| Gene Sequence | DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR |
| Gene ID - Mouse | ENSMUSG00000025064 |
| Gene ID - Rat | ENSRNOG00000012110 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation) | |
| Datasheet | Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation) | |
| Datasheet | Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation) |
| Citations for Anti COL17A1 pAb (ATL-HPA043673 w/enhanced validation) – 3 Found |
| Laval, S; Laklai, H; Fanjul, M; Pucelle, M; Laurell, H; Billon-Galés, A; Le Guellec, S; Delisle, M-B; Sonnenberg, A; Susini, C; Pyronnet, S; Bousquet, C. Dual roles of hemidesmosomal proteins in the pancreatic epithelium: the phosphoinositide 3-kinase decides. Oncogene. 2014;33(15):1934-44. PubMed |
| Ji, Andrew L; Rubin, Adam J; Thrane, Kim; Jiang, Sizun; Reynolds, David L; Meyers, Robin M; Guo, Margaret G; George, Benson M; Mollbrink, Annelie; Bergenstråhle, Joseph; Larsson, Ludvig; Bai, Yunhao; Zhu, Bokai; Bhaduri, Aparna; Meyers, Jordan M; Rovira-Clavé, Xavier; Hollmig, S Tyler; Aasi, Sumaira Z; Nolan, Garry P; Lundeberg, Joakim; Khavari, Paul A. Multimodal Analysis of Composition and Spatial Architecture in Human Squamous Cell Carcinoma. Cell. 2020;182(2):497-514.e22. PubMed |
| Jackson, Robert; Rajadhyaksha, Esha V; Loeffler, Reid S; Flores, Caitlyn E; Van Doorslaer, Koenraad. Characterization of 3D organotypic epithelial tissues reveals tonsil-specific differences in tonic interferon signaling. Biorxiv : The Preprint Server For Biology. 2023; 36711548( 36711548) PubMed |